PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.11G009400.1.p
Common NameGLYMA_11G009400, LOC100808232
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 294aa    MW: 33161.1 Da    PI: 6.7447
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.11G009400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.76.3e-191562148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g+W++eEd++lvd ++++G g+W++ +r  g++R++k+c++rw +yl
  Glyma.11G009400.1.p 15 KGPWSPEEDKILVDFIEKHGHGSWRALPRLAGLNRCGKSCRLRWTNYL 62
                         79********************************************97 PP

2Myb_DNA-binding51.72.1e-1668113148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                          rg+++ eE++l+++++  lG++ W++Ia++++ gRt++++k+ w+++l
  Glyma.11G009400.1.p  68 RGKFSDEEEQLIINLHSVLGNK-WAAIASHLP-GRTDNEIKNLWNTHL 113
                          89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.4731062IPR017930Myb domain
SuperFamilySSF466891.26E-3112109IPR009057Homeodomain-like
SMARTSM007172.4E-151464IPR001005SANT/Myb domain
PfamPF002495.3E-171562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-241669IPR009057Homeodomain-like
CDDcd001675.73E-121762No hitNo description
PROSITE profilePS5129426.3563117IPR017930Myb domain
SMARTSM007175.8E-1567115IPR001005SANT/Myb domain
PfamPF002492.6E-1568113IPR001005SANT/Myb domain
CDDcd001673.46E-1170113No hitNo description
Gene3DG3DSA:1.10.10.606.2E-2770118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MMRTPISSDE SGLKKGPWSP EEDKILVDFI EKHGHGSWRA LPRLAGLNRC GKSCRLRWTN  60
YLRPDIKRGK FSDEEEQLII NLHSVLGNKW AAIASHLPGR TDNEIKNLWN THLKKKLMQM  120
GLDPVTHRPR THHLNLLSNL QQILALIRLQ SDANKLQLLQ NIFEASNSDP LPDSSYSLLN  180
DVLGGLNNLH SNDLHNLYDG NSLSVQNFDQ NLNGGRNAEP SPSSNSLPNL VSASPDRSPV  240
VKEAQNILVN SKDFSTSAFE LTWGDFMDEE ETNQTYWKGF MDQHSNQTWS TFP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28131175108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150434e-82AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003538653.30.0PREDICTED: transcription repressor MYB6-like
TrEMBLI1LFY00.0I1LFY0_SOYBN; Uncharacterized protein
STRINGGLYMA11G01150.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.21e-80myb domain protein 9